PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0208s0190.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 400aa    MW: 43408.3 Da    PI: 7.5009
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0208s0190.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.6e-25150194145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr+v +g+++CErHlhrgr+rsrk++e+
  SapurV1A.0208s0190.2.p 150 DPEPGRCRRTDGKKWRCSRDVFAGHNYCERHLHRGRNRSRKPVEN 194
                             79****************************************997 PP

2QLQ47.45.9e-1780115237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             +F+ +Q+q+L+ Q+l+y+ ++a++ +PpeLlq+i+k
  SapurV1A.0208s0190.2.p  80 YFSLEQWQELELQALIYRFMLAGVAIPPELLQPIKK 115
                             6*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-1079115IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-1280113IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.84980115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.34150194IPR014977WRC domain
PfamPF088793.4E-21151193IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MDFHLKQRRN QHEESGQQPS AKTQKLLMDP HQAPQHPRSS GPAAFPLFLQ EPGSKISSLS  60
AFLDSSTAAN IRLPDIAGNY FSLEQWQELE LQALIYRFML AGVAIPPELL QPIKKSLLHP  120
HSPPCFLHHS LQQQCSYYQP SWYWGRADMD PEPGRCRRTD GKKWRCSRDV FAGHNYCERH  180
LHRGRNRSRK PVENPTPTIS TNVTCTGIGG AGGTASAAAF NHSAAPTISE VVNGTHFSHT  240
LESPSIHFNH SSKTESKGLI GSLPPNEEAG NRYDGHILWH FFDDWPRSVD ESGNVNGGSS  300
MNSLTCLSVS MPGNSPASDV SLKLSTGNNI AEPEPEPVPA PTPRGNTSKW AAAGWGTNIT  360
NQAVASMGGP LAEALSSSTT NSSPTSVLHQ LSRPTVSET*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018896.10.0PREDICTED: growth-regulating factor 3 isoform X2
SwissprotQ8L8A73e-82GRF4_ARATH; Growth-regulating factor 4
TrEMBLB9MTP80.0B9MTP8_POPTR; Uncharacterized protein
STRINGPOPTR_0006s11630.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-71growth-regulating factor 4